PDE5A anticorps (AA 20-63)

N° du produit ABIN5647895

Détail du produit anti-PDE5A anticorps

Antigène: PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))

Épitope: AA 20-63

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDE5A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 20-63 (QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH) from the human protein were used as the immunogen for the PDE5A antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the PDE5A antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the PDE5A antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur PDE5A

Antigène: PDE5A (phosphodiesterase 5A, cGMP-Specific (PDE5A))

Autre désignation: PDE5 (PDE5A Produits)

Synonymes: anticorps CGB-PDE, anticorps CN5A, anticorps PDE5, anticorps PDE5A2, anticorps Cgbpde, anticorps Cn5n, anticorps Pde5, anticorps Pde5a1, anticorps PDE5A, anticorps pde5a, anticorps cgb-pde, anticorps cn5a, anticorps pde5, anticorps pde5a1, anticorps phosphodiesterase 5A, anticorps phosphodiesterase 5A, cGMP-specific, anticorps phosphodiesterase 5A S homeolog, anticorps phosphodiesterase 5A, cGMP-specific, b, anticorps PDE5A, anticorps Pde5a, anticorps pde5a.S, anticorps pde5ab, anticorps pde5a

Sujet: CGMP-specific phosphodiesterase type 5 is an enzyme from the phosphodiesterase class. It is found in various tissues, most prominently the corpus cavernosum and the retina. It has also been recently discovered to play a vital role in the cardiovascular system. Furthermore, PDE5A also plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This PDE5A gene is mapped to 4q26.

UniProt: O76074

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling