Alpha-amylase 1 anticorps (AA 20-50)

N° du produit ABIN5647969

Détail du produit anti-Alpha-amylase 1 anticorps

Antigène: Alpha-amylase 1 (AMY1) (Amylase 1, Salivary (AMY1))

Épitope: AA 20-50

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Alpha-amylase 1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Purification: Antigen affinity purified

Immunogène: Amino acids 20-50 (NTQQGRTSIVHLFEWRWVDIALECERYLAPK) from the human protein were used as the immunogen for the Alpha Amylase antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the Alpha Amylase antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the Alpha Amylase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur Alpha-amylase 1

Antigène: Alpha-amylase 1 (AMY1) (Amylase 1, Salivary (AMY1))

Autre désignation: Alpha Amylase 1 (AMY1 Produits)

Sujet: Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.

UniProt: P04745