SLC45A2 anticorps (Solute Carrier Family 45, Member 2) (AA 1-243) Primary Antibody
SLC45A2
Reactivité: Humain
ELISA, WB
Hôte: Souris
Monoclonal
2F4
camera_alt 3
(1)
N° du produit ABIN565543
$440.00
Plus shipping costs $45.00
100 μg
local_shipping
Destination:
Etats-Unis
Envoi sous 11 à 12 jours ouvrables
-
- Antigène
- Épitope
- AA 1-243
- Reactivité
- Humain
- Hôte
- Souris
- Clonalité
- Monoclonal
- Application
- ELISA, Western Blotting (WB)
- Fonction
- Mouse monoclonal antibody raised against a full length recombinant SLC45A2.
- Réactivité croisée
- Humain
- Immunogène
immunogen: SLC45A2 (AAH03597, 1 a.a. ~ 243 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTDSQGNDIKVTAESTGEHASSLPLPLHQPPHWMDGLPVQHAVLHRFHGPDCVPRGSL
- Clone
- 2F4
- Isotype
- IgG2b kappa
-
-
- Indications d'application
- Optimal working dilution should be determined by the investigator.
- Commentaires
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Conseil sur la manipulation
- Aliquot to avoid repeated freezing and thawing.
- Stock
- -20 °C
- Stockage commentaire
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
-
Bin, Bhin, Yang, Shin, Nam, Choi, Shin, Lee, Hwang, Cho, Lee: "Membrane-Associated Transporter Protein (MATP) Regulates Melanosomal pH and Influences Tyrosinase Activity." dans: PLoS ONE, Vol. 10, Issue 6, pp. e0129273, 2015 (PubMed).
-
Bin, Bhin, Yang, Shin, Nam, Choi, Shin, Lee, Hwang, Cho, Lee: "Membrane-Associated Transporter Protein (MATP) Regulates Melanosomal pH and Influences Tyrosinase Activity." dans: PLoS ONE, Vol. 10, Issue 6, pp. e0129273, 2015 (PubMed).
-
- Antigène
- Autre désignation
- SLC45A2 (SLC45A2 Antibody Extrait)
- Synonymes
- SLC45A2, matp, aim1, im:7138762, MGC114950, 1A1, AIM1, MATP, OCA4, SHEP5, Aim-1, Aim1, Dbr, Matp, blanc-sale, bls, uw, solute carrier family 45 member 2, solute carrier family 45, member 2, solute carrier family 45 member 2 L homeolog, SLC45A2, slc45a2, slc45a2.L, Slc45a2
- Sujet
- Full Gene Name: solute carrier family 45, member 2
Synonyms: 1A1,AIM1,MATP,SHEP5 - ID gène
- 51151
Vous êtes ici: