SLC45A2 anticorps (C-Term)

N° du produit ABIN635265

Détail du produit anti-SLC45A2 anticorps

Antigène: SLC45A2 (Solute Carrier Family 45, Member 2 (SLC45A2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC45A2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC45 A2 antibody was raised against the C terminal of SLC45 2

Purification: Affinity purified

Immunogène: SLC45 A2 antibody was raised using the C terminal of SLC45 2 corresponding to a region with amino acids IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC45A2 Blocking Peptide, catalog no. 33R-3980, is also available for use as a blocking control in assays to test for specificity of this SLC45A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC45A2

Antigène: SLC45A2 (Solute Carrier Family 45, Member 2 (SLC45A2))

Autre désignation: SLC45A2 (SLC45A2 Produits)

Synonymes: anticorps SLC45A2, anticorps matp, anticorps aim1, anticorps im:7138762, anticorps MGC114950, anticorps 1A1, anticorps AIM1, anticorps MATP, anticorps OCA4, anticorps SHEP5, anticorps Aim-1, anticorps Aim1, anticorps Dbr, anticorps Matp, anticorps blanc-sale, anticorps bls, anticorps uw, anticorps solute carrier family 45 member 2, anticorps solute carrier family 45, member 2, anticorps solute carrier family 45 member 2 L homeolog, anticorps SLC45A2, anticorps slc45a2, anticorps slc45a2.L, anticorps Slc45a2

Sujet: SLC45A2 is a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4.

Poids moléculaire: 51 kDa (MW of target protein)