Emerin anticorps (N-Term)

N° du produit ABIN5692852

Détail du produit anti-Emerin anticorps

Antigène: Emerin (EMD)

Épitope: AA 1-48, N-Term

Reactivité: Humain

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp Emerin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS), Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro))

Marque: Picoband™

Séquence: MDNYADLSDT ELTTLLRRYN IPHGPVVGST RRLYEKKIFE YETQRRRL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Mouse IgG monoclonal antibody for Emerin detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Emerin (1-48aa MDNYADLSDTELTTLLRRYNIPHGPVVGSTRRLYEKKIFEYETQRRRL), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino ac

Clone: 5A10

Isotype: IgG1

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
Immunohistochemistry(Frozen Section), 0.5-1 μg/mL
Immunocytochemistry, 0.5-1 μg/mL
Flow Cytometry, 1-3 μg/1x10⁶ cells

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur Emerin

Antigène: Emerin (EMD)

Autre désignation: EMD (EMD Produits)

Synonymes: anticorps fj58f01, anticorps wu:fj58f01, anticorps EMD, anticorps Bocks, anticorps Bocksbeutel, anticorps CG9424, anticorps Dmel\\CG9424, anticorps emerin, anticorps emd, anticorps xemd1, anticorps xemerin2, anticorps xemd2, anticorps xemerin1, anticorps EDMD, anticorps LEMD5, anticorps STA, anticorps AW550900, anticorps Sta, anticorps emerin, anticorps emerin (Emery-Dreifuss muscular dystrophy), anticorps bocksbeutel, anticorps emerin L homeolog, anticorps emerin S homeolog, anticorps EMD, anticorps emd, anticorps bocks, anticorps emd.L, anticorps emd.S, anticorps Emd

Sujet:

Synonyms: Emerin, EMD, EDMD, STA

Tissue Specificity: Skeletal muscle, heart, colon, testis, ovary and pancreas.

UniProt: P50402