Retinoblastoma Binding Protein 4 anticorps (C-Term)
-
- Antigène Voir toutes Retinoblastoma Binding Protein 4 (RBBP4) Anticorps
- Retinoblastoma Binding Protein 4 (RBBP4)
-
Épitope
- AA 395-425, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Souris
-
Clonalité
- Monoclonal
-
Conjugué
- Cet anticorp Retinoblastoma Binding Protein 4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Marque
- Picoband™
- Séquence
- EDNIMQVWQM AENIYNDEDP EGSVDPEGQG S
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Mouse IgG monoclonal antibody for RbAp48 detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.
- Clone
- 9F3
- Isotype
- IgG1
- Top Product
- Discover our top product RBBP4 Anticorps primaire
-
-
- Indications d'application
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stockage commentaire
-
At -20℃, for one year. After reconstitution, at 4℃, for one month.
It can also be aliquotted and stored frozen at -20℃, for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- Retinoblastoma Binding Protein 4 (RBBP4)
- Autre désignation
- RBBP4 (RBBP4 Produits)
- Synonymes
- anticorps NURF55, anticorps RBAP48, anticorps 154659_at, anticorps 55, anticorps CAF-1, anticorps CAF1, anticorps CAF1-55, anticorps CAF1p55, anticorps CG4236, anticorps Caf-1, anticorps Caf1/p55, anticorps Caf1p55, anticorps Dmel\\CG4236, anticorps MSI1/RbAp48/CAC3/LIN-53, anticorps NURF, anticorps NURF-55, anticorps Nurf, anticorps Nurf 55, anticorps Nurf-55, anticorps Nurf55, anticorps P55, anticorps RbAp48, anticorps S(ls)3, anticorps caf-1, anticorps caf1, anticorps caf1 p55, anticorps d-CAF1, anticorps dCAF-1, anticorps dCAF-1 p55, anticorps dNURF, anticorps p55, anticorps p55 CAF1, anticorps p55/NURF-55, anticorps p55CAF1, anticorps nurf55, anticorps rbap48, anticorps xrbbp4, anticorps mRbAp48, anticorps RBBP4, anticorps rbb4-2, anticorps zgc:55349, anticorps zgc:77854, anticorps wu:fb33a09, anticorps wu:fb40e10, anticorps RBBP-4, anticorps rbbp4, anticorps M4E13.110, anticorps M4E13_110, anticorps MULTICOPY SUPPRESSOR OF IRA1 3, anticorps NFC3, anticorps NUCLEOSOME/CHROMATIN ASSEMBLY FACTOR GROUP C 3, anticorps RB binding protein 4, chromatin remodeling factor, anticorps Chromatin assembly factor 1, p55 subunit, anticorps retinoblastoma binding protein 4, anticorps retinoblastoma binding protein 4, chromatin remodeling factor, anticorps retinoblastoma binding protein 4 L homeolog, anticorps Transducin family protein / WD-40 repeat family protein, anticorps retinoblastoma binding protein 4 S homeolog, anticorps RBBP4, anticorps Caf1-55, anticorps rbbp4, anticorps Rbbp4, anticorps rbbp4.L, anticorps MSI3, anticorps rbbp4.S
- Sujet
-
Synonyms: Histone-binding protein RBBP4, Chromatin assembly factor 1 subunit C, CAF-1 subunit C, Chromatin assembly factor I p48 subunit, CAF-I 48 kDa subunit, CAF-I p48, Nucleosome-remodeling factor subunit RBAP48, Retinoblastoma-binding protein 4, RBBP-4, Retinoblastoma-binding protein p48, RBBP4, RBAP48
Background: Histone-binding protein RBBP4 (also known as RbAp48, or NURF55) is a protein that in humans is encoded by the RBBP4 gene. This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly. And it is part of the Mi-2 complex which has been implicated in chromatin remodeling and transcriptional repression associated with histone deacetylation. This encoded protein is also part of co-repressor complexes, which is an integral component of transcriptional silencing. It is found among several cellular proteins that bind directly to retinoblastoma protein to regulate cell proliferation. This protein also seems to be involved in transcriptional repression of E2F-responsive genes. Three transcript variants encoding different isoforms have been found for this gene.
- UniProt
- Q09028
- Pathways
- Cycle Cellulaire, Mitotic G1-G1/S Phases, Stem Cell Maintenance, Chromatin Binding, Protein targeting to Nucleus
-