ABCC8 anticorps
-
- Antigène Voir toutes ABCC8 Anticorps
- ABCC8 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ABCC8 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Flow Cytometry (FACS)
- Marque
- Picoband™
- Séquence
- TIQREGTLKD FQRSECQLFE HWKTLMNRQD QELEKETVTE RKA
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
- Rabbit IgG polyclonal antibody for SUR1 detection. Tested with WB, IHC-F, ICC, FCM in Human,Mouse,Rat.
- Immunogène
- A synthetic peptide corresponding to a sequence of human SUR1 (TIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVTERKA).
- Top Product
- Discover our top product ABCC8 Anticorps primaire
-
-
- Indications d'application
-
Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(F) and ICC.
Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Frozen Section), 0.5-1 μg/mL
Immunocytochemistry, 0.5-1 μg/mL
Flow Cytometry, 1-3 μg/1x106 cells - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Buffer
- Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Stock
- 4 °C,-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- ABCC8 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8))
- Autre désignation
- ABCC8 (ABCC8 Produits)
- Synonymes
- anticorps ABC36, anticorps HHF1, anticorps HI, anticorps HRINS, anticorps MRP8, anticorps PHHI, anticorps SUR, anticorps SUR1, anticorps SUR1delta2, anticorps TNDM2, anticorps D930031B21Rik, anticorps Sur, anticorps Sur1, anticorps ATP binding cassette subfamily C member 8, anticorps ATP-binding cassette, sub-family C (CFTR/MRP), member 8, anticorps ABCC8, anticorps Abcc8
- Sujet
-
Synonyms: ATP-binding cassette sub-family C member 8, Sulfonylurea receptor 1, ABCC8, HRINS, SUR, SUR1
Background: ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene.
- UniProt
- Q09428
- Pathways
- Negative Regulation of Hormone Secretion
-