ABCB1 anticorps

N° du produit ABIN5693064

Détail du produit anti-ABCB1 anticorps

Antigène: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCB1 est non-conjugé

Application: Western Blotting (WB)

Séquence: QAQDRKLSTK EALDESIPPV SFWRIMKLNL TEWPY

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for P Glycoprotein detection. Tested with WB in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human P Glycoprotein (QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-ABCB1 (ABIN5693064)

Chen, Liu, Chen, Xu, Xiao, Hu, Mao, Wang: "A 20(S)-protopanoxadiol derivative overcomes multi-drug resistance by antagonizing ATP-binding cassette subfamily B member 1 transporter function." dans: Oncotarget, Vol. 7, Issue 8, pp. 9388-403, (2017) (PubMed).

Détails sur ABCB1

Antigène: ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))

Autre désignation: ABCB1 (ABCB1 Produits)

Synonymes: anticorps ABC20, anticorps CD243, anticorps CLCS, anticorps GP170, anticorps MDR1, anticorps P-GP, anticorps PGY1, anticorps Abcb1, anticorps Mdr1a, anticorps p-gp, anticorps xemdr, anticorps Mdr1, anticorps Mdr1b, anticorps Pgy-1, anticorps Pgy1, anticorps mdr, anticorps ABCB1, anticorps PGP1, anticorps ATP binding cassette subfamily B member 1, anticorps ATP binding cassette subfamily B member 1A, anticorps ATP binding cassette subfamily B member 1 L homeolog, anticorps ATP-binding cassette, sub-family B (MDR/TAP), member 1B, anticorps ABCB1, anticorps Abcb1a, anticorps abcb1.L, anticorps Abcb1b, anticorps Abcb1

Sujet:

Synonyms: Multidrug resistance protein 1, ATP-binding cassette sub-family B member 1, P-glycoprotein 1, CD243, ABCB1, MDR1, PGY1

Tissue Specificity: Expressed in liver, kidney, small intestine and brain.

Background: P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.

UniProt: P08183