CEP68 anticorps

N° du produit ABIN5693149

Détail du produit anti-CEP68 anticorps

Antigène: CEP68 (Centrosomal Protein 68kDa (CEP68))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CEP68 est non-conjugé

Application: Western Blotting (WB)

Marque: Picoband™

Séquence: ELICWLYNVA DVTDHGTAAR SNLTSLKSSL QLYRQFKKDI D

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for CEP68 detection. Tested with WB in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human CEP68 (ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur CEP68

Antigène: CEP68 (Centrosomal Protein 68kDa (CEP68))

Autre désignation: CEP68 (CEP68 Produits)

Synonymes: anticorps RGD1309101, anticorps 6030463E10Rik, anticorps AI481761, anticorps BC027174, anticorps Kiaa0582, anticorps KIAA0582, anticorps centrosomal protein 68, anticorps Cep68, anticorps CEP68

Sujet:

Synonyms: Centrosomal protein of 68 kDa, Cep68, CEP68, KIAA0582

Background: Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and rootletin depend both on each other for centriole association, and both also require CEP250 for their function.

UniProt: Q76N32

Pathways: SARS-CoV-2 Protein Interactome