ASXL1 anticorps

N° du produit ABIN5693162

Détail du produit anti-ASXL1 anticorps

Antigène: ASXL1 (Additional Sex Combs Like 1 (ASXL1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASXL1 est non-conjugé

Application: Western Blotting (WB)

Marque: Picoband™

Séquence: KKERTWAEAA RLVLENYSDA PMTPKQILQV IEAE

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for ASXL1 detection. Tested with WB in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence of human ASXL1 (KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE).

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.

Application Details: Western blot, 0.1-0.5 μg/mL

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.

Détails sur ASXL1

Antigène: ASXL1 (Additional Sex Combs Like 1 (ASXL1))

Autre désignation: ASXL1 (ASXL1 Produits)

Synonymes: anticorps asxl1, anticorps MGC83850, anticorps mKIAA0978, anticorps BOPS, anticorps MDS, anticorps additional sex combs like 1, transcriptional regulator L homeolog, anticorps additional sex combs like 1, transcriptional regulator, anticorps additional sex combs like 1, anticorps asxl1.L, anticorps ASXL1, anticorps asxl1, anticorps Asxl1

Sujet:

Synonyms: Putative Polycomb group protein ASXL1, Additional sex combs-like protein 1, ASXL1, KIAA0978

Tissue Specificity: Widely expressed at low level. Expressed in heart, brain, skeletal muscle, placenta, pancreas, spleen, prostate, small intestine, colon, peripheral blood, leukocytes, bone marrow and fetal liver. Highly expressed in testes.

Background: Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants.

Pathways: Retinoic Acid Receptor Signaling Pathway