HSP70 1A anticorps (C-Term)

N° du produit ABIN5693238

Détail du produit anti-HSP70 1A anticorps

Antigène: HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))

Épitope: AA 559-596, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Souris

Clonalité: Monoclonal

Conjugué: Cet anticorp HSP70 1A est non-conjugé

Application: Western Blotting (WB), Immunocytochemistry (ICC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Flow Cytometry (FACS), Immunohistochemistry (Frozen Sections) (IHC (fro))

Marque: Picoband™

Séquence: KGKISEADKK KVLDKCQEVI SWLDANTLAE KDEFEHKR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Mouse IgG monoclonal antibody for Hsp70 detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human,Mouse,Rat.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

Clone: 3H5

Isotype: IgG1

Information d'application

Indications d'application:

Recommended Detection Systems: Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Application Details: Western blot, 0.1-0.5 μg/mL
Immunohistochemistry(Paraffin-embedded Section), 0.5-1 μg/mL
Immunohistochemistry(Frozen Section), 0.5-1 μg/mL
Immunocytochemistry, 0.5-1 μg/mL
Flow Cytometry, 1-3 μg/1x10⁶ cells

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Buffer: Each vial contains 4 mg Trehalose, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Stockage commentaire: At -20℃, for one year. After reconstitution, at 4℃, for one month.
It can also be aliquotted and stored frozen at -20℃, for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-HSP70 1A (ABIN5693238)

Zhang, Tang, Li, Li, Zhang, Yan, Cui: "Effects of intracerebral hemorrhage and subsequent minimally invasive hematoma aspiration on expression of apoptosisrelated genes in rats." dans: International journal of clinical and experimental pathology, Vol. 8, Issue 5, pp. 5371-8, (2016) (PubMed).

Pu, Shi, Wang, Wang, Guo, Liu, Sun, Gao, Zhou: "Effects of minocycline on the expression of NGF and HSP70 and its neuroprotection role following intracerebral hemorrhage in rats." dans: Journal of biomedical research, Vol. 25, Issue 4, pp. 292-8, (2013) (PubMed).

Li, Roubeix, Wang, Shi, Liu, Baudouin, Chen: "Therapeutic efficacy of trehalose eye drops for treatment of murine dry eye induced by an intelligently controlled environmental system." dans: Molecular vision, Vol. 18, pp. 317-29, (2012) (PubMed).

Yi, Peng, Chang, Peng, Yan, Lin: "Effect of pre-moxibustion on apoptosis and proliferation of gastric mucosa cells." dans: World journal of gastroenterology, Vol. 13, Issue 15, pp. 2174-8, (2007) (PubMed).

Wu, Cao, Gao, Chen, Wang, Zumbika, Qian: "Down-modulation of heat shock protein 70 and up-modulation of Caspase-3 during schisandrin B-induced apoptosis in human hepatoma SMMC-7721 cells." dans: World journal of gastroenterology, Vol. 10, Issue 20, pp. 2944-8, (2004) (PubMed).

Détails sur HSP70 1A

Antigène: HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))

Autre désignation: HSPA1A (HSPA1A Produits)

Synonymes: anticorps hsp70-4, anticorps hspa1a, anticorps Hsp70-3, anticorps Hsp70.3, anticorps Hsp72, anticorps hsp68, anticorps hsp70A1, anticorps HSP72, anticorps Hsp70-1, anticorps Hspa1, anticorps Hspa1b, anticorps hsp70-1, anticorps hsp70-1a, anticorps hsp70i, anticorps hsp72, anticorps hspa1, anticorps hspa1b, anticorps HSP70-1, anticorps HSP70-1A, anticorps HSP70I, anticorps HSPA1, anticorps HSPA1A, anticorps HSPA1B, anticorps HSP70-2, anticorps HSPA2, anticorps HSP70, anticorps hspA1A, anticorps heat shock cognate 70-kd protein, tandem duplicate 3, anticorps heat shock 70 kDa protein 1, anticorps heat shock 70 kDa protein II, anticorps heat shock protein 1A, anticorps heat shock 70kD protein 1A, anticorps heat shock protein family A (Hsp70) member 1A S homeolog, anticorps heat shock protein family A (Hsp70) member 1A, anticorps heat shock protein 70.2, anticorps heat shock 70kDa protein 1A, anticorps heat shock 70 kDa protein 1B, anticorps heat shock protein 70.1, anticorps hsp70.3, anticorps LOC100023597, anticorps LOC100554002, anticorps LOC100608888, anticorps Hspa1a, anticorps hspa1a.S, anticorps HSPA1A, anticorps HSP70.2, anticorps LOC100354037, anticorps HSP70.1

Sujet:

Synonyms: Heat shock 70 kDa protein 1A, Heat shock 70 kDa protein 1B

Background: HSPA1 (heat shock 70  kDa protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70  kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No protein was associated with expression of this short HSPA1A mRNA, possibly due to lack of a TATA box or loss of internal ribosome binding sites. Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, improved muscular architecture, strength, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice.

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process