NFIB anticorps

N° du produit ABIN5708262

L’anticorps Lapin Polyclonal anti-NFIB a été validé pour WB et IHC (p). Il convient pour détecter NFIB dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour NFIB anticorps (ABIN5708262)

Antigène: NFIB (Nuclear Factor I/B (NFIB))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NFIB est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-NFIB anticorps

Purification: Antigen affinity purified

Immunogène: Amino acids ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR were used as the immunogen for the NFIB antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the NFIB antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL, IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the NFIB antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur NFIB

Antigène: NFIB (Nuclear Factor I/B (NFIB))

Autre désignation: NFIB / Nuclear factor 1 B-type

Sujet: Recognizes and binds the palindromic sequence 5'-TTGGCNNNNNGCCAA-3' present in viral and cellular promoters and in the origin of replication of adenovirus type 2. These proteins are individually capable of activating transcription and replication. [UniProt]

UniProt: O00712