CCR3 anticorps

N° du produit ABIN5708366

Cet anticorps Lapin Polyclonal détecte spécifiquement CCR3 dans WB et FACS. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour CCR3 anticorps (ABIN5708366)

Antigène: CCR3 (Chemokine (C-C Motif) Receptor 3 (CCR3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCR3 est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS)

Détail du produit anti-CCR3 anticorps

Purification: Antigen affinity purified

Immunogène: Amino acids MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMA were used as the immunogen for the CCR3 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the CCR3 antibody should be determined by the researcher.\. Western blot: 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the CCR3 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur CCR3

Antigène: CCR3 (Chemokine (C-C Motif) Receptor 3 (CCR3))

Autre désignation: CCR3

Sujet: C-C chemokine receptor type 3, also called CCR3 or CKR3 is a protein that in humans is encoded by the CCR3 gene. The protein encoded by this gene is a receptor for C-C type chemokines. It belongs to family 1 of the G protein-coupled receptors. This gene and seven other chemokine receptor genes form a chemokine receptor gene cluster on the chromosomal region 3p21. This receptor binds and responds to a variety of chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). It is highly expressed in eosinophils and basophils, and is also detected in TH1 and TH2 cells, as well as in airway epithelial cells. This receptor may contribute to the accumulation and activation of eosinophils and other inflammatory cells in the allergic airway. It is also known to be an entry co-receptor for HIV-1. Alternatively spliced transcript variants have been described.

UniProt: P51677