SIRT5 anticorps (C-Term)

N° du produit ABIN629582

L’anticorps anti-SIRT5 Polyclonal Lapin est utilisé pour la détection de SIRT5 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour SIRT5 anticorps (C-Term) (ABIN629582)

Antigène: SIRT5 (Sirtuin 5 (SIRT5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIRT5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SIRT5 anticorps

Épitope: C-Term

Specificité: SIRT5 antibody was raised against the C terminal of SIRT5

Purification: Purified

Immunogène: SIRT5 antibody was raised using the C terminal of SIRT5 corresponding to a region with amino acids HCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFSHLIS

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIRT5 Blocking Peptide, (ABIN939084), is also available for use as a blocking control in assays to test for specificity of this SIRT5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIRT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIRT5

Antigène: SIRT5 (Sirtuin 5 (SIRT5))

Autre désignation: SIRT5

Sujet: SIRT5 is included in class III of the sirtuin family which ischaracterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome