CBS anticorps (N-Term)

N° du produit ABIN629598

Détail du produit anti-CBS anticorps

Antigène: CBS (Cystathionine-beta-Synthase (CBS))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CBS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: CBS antibody was raised against the N terminal of CBS

Purification: Purified

Immunogène: CBS antibody was raised using the N terminal of CBS corresponding to a region with amino acids RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CBS Blocking Peptide, catalog no. 33R-7836, is also available for use as a blocking control in assays to test for specificity of this CBS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-CBS (ABIN629598)

Veerareddy, Dao, Yun, Stokes, Disbrow, Kevil, Cvek, Trutschl, Kilgore, Ramanathan, Zivadinov, Alexander: "Dysregulated Sulfide Metabolism in Multiple Sclerosis: Serum and Vascular Endothelial Inflammatory Responses." dans: Pathophysiology : the official journal of the International Society for Pathophysiology, Vol. 29, Issue 3, pp. 570-582, (2022) (PubMed).

Détails sur CBS

Antigène: CBS (Cystathionine-beta-Synthase (CBS))

Autre désignation: CBS (CBS Produits)

Synonymes: anticorps hip4, anticorps GB12529, anticorps CBS, anticorps DDBDRAFT_0189727, anticorps DDBDRAFT_0191292, anticorps DDB_0189727, anticorps DDB_0191292, anticorps cbs, anticorps AI047524, anticorps AI303044, anticorps HIP4, anticorps cb442, anticorps wu:fb37g05, anticorps wu:fm61c07, anticorps wu:fq06c06, anticorps zgc:113704, anticorps cystathionine-beta-synthase L homeolog, anticorps cystathionine-beta-synthase, anticorps cystathionine beta-synthase, anticorps cystathionine beta-synthase CBS, anticorps cystathionine beta synthase, anticorps cystathionine-beta-synthase S homeolog, anticorps cystathionine-beta-synthase b, anticorps cbs.L, anticorps cbs, anticorps Cbs, anticorps CBS, anticorps CNA06170, anticorps Tb11.02.5400, anticorps cysB, anticorps LOC100635325, anticorps cbs.S, anticorps cbsb

Sujet: CBS is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.

Poids moléculaire: 60 kDa (MW of target protein)