PRMT5 anticorps (N-Term)

N° du produit ABIN629605

Détail du produit anti-PRMT5 anticorps

Antigène: PRMT5 (Protein Arginine Methyltransferase 5 (PRMT5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRMT5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: PRMT5 antibody was raised against the N terminal of PRMT5

Purification: Purified

Immunogène: PRMT5 antibody was raised using the N terminal of PRMT5 corresponding to a region with amino acids FDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLS

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRMT5 Blocking Peptide, catalog no. 33R-2864, is also available for use as a blocking control in assays to test for specificity of this PRMT5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRMT5

Antigène: PRMT5 (Protein Arginine Methyltransferase 5 (PRMT5))

Autre désignation: PRMT5 (PRMT5 Produits)

Synonymes: anticorps HRMT1L5, anticorps IBP72, anticorps JBP1, anticorps SKB1, anticorps SKB1Hs, anticorps Jbp1, anticorps Skb1, anticorps si:zc14a17.2, anticorps skb1, anticorps wu:fb95f10, anticorps zgc:110669, anticorps hsl7, anticorps DDBDRAFT_0187422, anticorps DDBDRAFT_0235403, anticorps DDB_0187422, anticorps DDB_0235403, anticorps NV18830, anticorps jbp1, anticorps ibp72, anticorps skb1hs, anticorps hrmt1l5, anticorps protein arginine methyltransferase 5, anticorps protein arginine N-methyltransferase 5, anticorps protein arginine methyltransferase 5 L homeolog, anticorps putative arginine N-methyltransferase, type II, anticorps Skb1 family protein, anticorps Protein arginine N-methyltransferase 5, anticorps PRMT5, anticorps Prmt5, anticorps prmt5, anticorps prmt5.L, anticorps LOC100115766, anticorps prmt-5

Sujet: PRMT5 methylates specific arginine residues in the small nuclear ribonucleoproteins Sm D1 and Sm D3 to monomethylarginine and to symmetrical dimethylarginines (sDMAs). It methylates SUPT5H. PRMT5 plays a role in the assembly of snRNP core particles and may play a role in cytokine-activated transduction pathways. It negatively regulates cyclin E1 promoter activity and cellular proliferation and May regulate the SUPT5H transcriptional elongation properties. It may be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. PRMT5 methylates histone H2A/H4 'Arg-3' during germ cell development and methylates histone H3 'Arg-8', which may repress transcription.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Chromatin Binding, Regulation of Muscle Cell Differentiation, Ribonucleoprotein Complex Subunit Organization, Skeletal Muscle Fiber Development