CENPA anticorps (N-Term)

N° du produit ABIN629608

Détail du produit anti-CENPA anticorps

Antigène: CENPA (Centromere Protein A (CENPA))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CENPA est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: CENPA antibody was raised against the N terminal of CENPA

Purification: Purified

Immunogène: CENPA antibody was raised using the N terminal of CENPA corresponding to a region with amino acids MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CENPA Blocking Peptide, catalog no. 33R-6060, is also available for use as a blocking control in assays to test for specificity of this CENPA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CENPA

Antigène: CENPA (Centromere Protein A (CENPA))

Autre désignation: CENPA (CENPA Produits)

Synonymes: anticorps CENP-A, anticorps CenH3, anticorps Cenp-A, anticorps cenpx, anticorps cenp-a, anticorps sim2, anticorps Cenp-a, anticorps RGD1563607, anticorps CENPA, anticorps centromere protein A, anticorps centromere protein-A, anticorps centromeric histone-3 like protein, anticorps centromere-specific histone H3 CENP-A, anticorps cenp-A, anticorps centromere protein A L homeolog, anticorps histone H3-like centromeric protein A, anticorps CENPA, anticorps Cenpa, anticorps CENP-A, anticorps cenpa, anticorps cenp-A, anticorps cnp1, anticorps HAN_3g422, anticorps Cenp-a, anticorps cenpa.L, anticorps CMU_016480

Sujet: Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.

Poids moléculaire: 16 kDa (MW of target protein)

Pathways: Chromatin Binding, Maintenance of Protein Location