PEX3 anticorps (N-Term)
-
- Antigène Voir toutes PEX3 Anticorps
- PEX3 (Peroxisomal Biogenesis Factor 3 (PEX3))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PEX3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- PEX3 antibody was raised against the N terminal of PEX3
- Purification
- Purified
- Immunogène
- PEX3 antibody was raised using the N terminal of PEX3 corresponding to a region with amino acids KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL
- Top Product
- Discover our top product PEX3 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PEX3 Blocking Peptide, catalog no. 33R-4740, is also available for use as a blocking control in assays to test for specificity of this PEX3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PEX3 (Peroxisomal Biogenesis Factor 3 (PEX3))
- Autre désignation
- PEX3 (PEX3 Produits)
- Sujet
- PEX3 is involved in peroxisome biosynthesis and integrity. It assembles membrane vesicles before the matrix proteins are translocated. As a docking factor for PEX19, it is necessary for the import of peroxisomal membrane proteins in the peroxisomes.
- Poids moléculaire
- 42 kDa (MW of target protein)
-