Cnpase anticorps (N-Term)

N° du produit ABIN629627

Détail du produit anti-Cnpase anticorps

Antigène: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cnpase est non-conjugé

Application: Western Blotting (WB)

Specificité: CNP antibody was raised against the N terminal of CNP

Purification: Purified

Immunogène: CNP antibody was raised using the N terminal of CNP corresponding to a region with amino acids YKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILVLDDTNHERERLEQLF

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CNP Blocking Peptide, catalog no. 33R-10149, is also available for use as a blocking control in assays to test for specificity of this CNP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cnpase

Antigène: Cnpase (CNP) (2',3'-Cyclic Nucleotide 3' phosphodiesterase (CNP))

Autre désignation: CNP (CNP Produits)

Synonymes: anticorps CNP1, anticorps CNPase, anticorps Cnp-1, anticorps Cnp1, anticorps CNPF, anticorps CNPI, anticorps CNPII, anticorps CNP, anticorps DKFZp469F1421, anticorps cnpl, anticorps fd21d08, anticorps fi37a10, anticorps rich, anticorps sb:cb662, anticorps si:ch73-158e11.4, anticorps wu:fd21d08, anticorps wu:fd44a05, anticorps wu:fi35d08, anticorps wu:fi37a10, anticorps cnp, anticorps 2',3'-cyclic nucleotide 3' phosphodiesterase, anticorps CNP, anticorps Cnp, anticorps cnp, anticorps cnp.L

Sujet: 2',3'-Cyclic nucleotide-3'-phosphodiesterase (CNP1 and CNP2) is the major enzyme of central nervous system myelin. It is associated with oligodendroglial plasma membrane and uncompacted myelin (myelin-like fraction), which are in contact with glial cytoplasm.

Poids moléculaire: 45 kDa (MW of target protein)