PSME3 anticorps (C-Term)

N° du produit ABIN629645

Détail du produit anti-PSME3 anticorps

Antigène: PSME3

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSME3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PSME3 antibody was raised against the C terminal of PSME3

Purification: Purified

Immunogène: PSME3 antibody was raised using the C terminal of PSME3 corresponding to a region with amino acids TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSME3 Blocking Peptide, catalog no. 33R-9372, is also available for use as a blocking control in assays to test for specificity of this PSME3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSME3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSME3

Antigène: PSME3

Autre désignation: PSME3 (PSME3 Produits)

Synonymes: anticorps AA410043, anticorps AU020960, anticorps Ki, anticorps PA28gamma, anticorps REGgamma, anticorps pa28g, anticorps Ab2-371, anticorps PA28-gamma, anticorps PA28G, anticorps REG-GAMMA, anticorps psme3b, anticorps proteaseome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki), anticorps proteasome activator subunit 3, anticorps proteasome activator subunit 3 S homeolog, anticorps Psme3, anticorps PSME3, anticorps psme3.S

Sujet: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. PSME3 is the gamma subunit of the 11S regulator.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Positive Regulation of Endopeptidase Activity, Hepatitis C, Synthesis of DNA