MDH2 anticorps

N° du produit ABIN629663

Détail du produit anti-MDH2 anticorps

Antigène: MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MDH2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: MDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYFSTPLLLGKKGIEKNLGIGKVSSFEEKMISDAIPELKASIKKGEDFVK

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MDH2 Blocking Peptide, catalog no. 33R-9388, is also available for use as a blocking control in assays to test for specificity of this MDH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MDH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MDH2

Antigène: MDH2 (Malate Dehydrogenase 2, NAD (Mitochondrial) (MDH2))

Autre désignation: MDH2 (MDH2 Produits)

Synonymes: anticorps Mdh2b, anticorps m-mdh, anticorps mdh2, anticorps mor1, anticorps MDH-2, anticorps Mdh, anticorps wu:fj48c08, anticorps wu:fj55d06, anticorps zgc:64133, anticorps M-MDH, anticorps MDH, anticorps MGC:3559, anticorps MOR1, anticorps MMDH, anticorps Mdh-2, anticorps Mor-1, anticorps Mor1, anticorps malate dehydrogenase 2 S homeolog, anticorps malate dehydrogenase 2, anticorps Malate dehydrogenase 2, anticorps malate dehydrogenase, anticorps malate dehydrogenase 2, NAD (mitochondrial), anticorps mdh2.S, anticorps MDH2, anticorps Mdh2, anticorps MDH4, anticorps mdh2

Sujet: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. MDH2 is localized to the mitochondria and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle.

Poids moléculaire: 33 kDa (MW of target protein)