PDHA1 anticorps

N° du produit ABIN629668

Cet anticorps Lapin Polyclonal détecte spécifiquement PDHA1 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PDHA1 anticorps (ABIN629668)

Antigène: PDHA1 (Pyruvate Dehydrogenase (Lipoamide) alpha 1 (PDHA1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDHA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDHA1 anticorps

Purification: Purified

Immunogène: PDHA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDRMVNSNLASVEELKEIDVEVRKEIEDAAQFATADPEPPLEELGYHIYS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDHA1 Blocking Peptide, (ABIN939690), is also available for use as a blocking control in assays to test for specificity of this PDHA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDHA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDHA1

Antigène: PDHA1 (Pyruvate Dehydrogenase (Lipoamide) alpha 1 (PDHA1))

Autre désignation: PDHA1

Sujet: The pyruvate dehydrogenase complex is a nuclear-encoded mitochondrial matrix multienzyme complex that provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle by catalyzing the irreversible conversion of pyruvate into acetyl-CoA. The PDH complex is composed of multiple copies of 3 enzymes: E1 (PDHA1), dihydrolipoyl transacetylase (DLAT), and dihydrolipoyl dehydrogenase (DLD).

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: L'effet Warburg