IDH3A anticorps

N° du produit ABIN629675

Détail du produit anti-IDH3A anticorps

Antigène: IDH3A (Isocitrate Dehydrogenase 3 (NAD+) alpha (IDH3A))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IDH3A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: IDH3 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IDH3A Blocking Peptide, catalog no. 33R-6142, is also available for use as a blocking control in assays to test for specificity of this IDH3A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IDH3A

Antigène: IDH3A (Isocitrate Dehydrogenase 3 (NAD+) alpha (IDH3A))

Autre désignation: IDH3A (IDH3A Produits)

Synonymes: anticorps idh3a, anticorps MGC76128, anticorps IDH3A, anticorps zgc:56380, anticorps zgc:85631, anticorps BG1, anticorps 1110003P10Rik, anticorps 1500012E04Rik, anticorps AA407078, anticorps AI316514, anticorps isocitrate dehydrogenase 3 (NAD+) alpha, anticorps isocitrate dehydrogenase 3 (NAD(+)) alpha, anticorps isocitrate dehydrogenase 3 (NAD+) alpha S homeolog, anticorps idh3a, anticorps IDH3A, anticorps idh3a.S, anticorps Idh3a

Sujet: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit.

Poids moléculaire: 40 kDa (MW of target protein)