ALDH4A1 anticorps (N-Term)

N° du produit ABIN629678

L’anticorps Lapin Polyclonal anti-ALDH4A1 a été validé pour WB et IHC. Il convient pour détecter ALDH4A1 dans des échantillons de Humain.

Aperçu rapide pour ALDH4A1 anticorps (N-Term) (ABIN629678)

Antigène: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH4A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ALDH4A1 anticorps

Épitope: N-Term

Specificité: ALDH4 A1 antibody was raised against the N terminal of ALDH4 1

Purification: Purified

Immunogène: ALDH4 A1 antibody was raised using the N terminal of ALDH4 1 corresponding to a region with amino acids QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDH4A1 Blocking Peptide, (ABIN5612011), is also available for use as a blocking control in assays to test for specificity of this ALDH4A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDH4A1

Antigène: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Autre désignation: ALDH4A1

Sujet: ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process