ALDH4A1 anticorps (C-Term)

N° du produit ABIN629679

Cet anticorps anti-ALDH4A1 est un anticorps Lapin Polyclonal détectant ALDH4A1 dans WB et IHC. Adapté pour Humain, Souris, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour ALDH4A1 anticorps (C-Term) (ABIN629679)

Antigène: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Reactivité: Humain, Souris, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH4A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ALDH4A1 anticorps

Épitope: C-Term

Specificité: ALDH4 A1 antibody was raised against the C terminal of ALDH4 1

Purification: Purified

Immunogène: ALDH4 A1 antibody was raised using the C terminal of ALDH4 1 corresponding to a region with amino acids RNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVI

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDH4A1 Blocking Peptide, (ABIN5612012), is also available for use as a blocking control in assays to test for specificity of this ALDH4A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDH4A1

Antigène: ALDH4A1 (Aldehyde Dehydrogenase 4 Family, Member A1 (ALDH4A1))

Autre désignation: ALDH4A1

Sujet: ALDH4A1 belongs to the aldehyde dehydrogenase family of proteins. This enzyme is a mitochondrial matrix NAD-dependent dehydrogenase which catalyzes the second step of the proline degradation pathway, converting pyrroline-5-carboxylate to glutamate. Deficiency of this enzyme is associated with type II hyperprolinemia, an autosomal recessive disorder characterized by accumulation of delta-1-pyrroline-5-carboxylate (P5C) and proline.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process