CROT anticorps (N-Term)

N° du produit ABIN629682

Détail du produit anti-CROT anticorps

Antigène: CROT (Carnitine O-Octanoyltransferase (CROT))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CROT est non-conjugé

Application: Western Blotting (WB)

Specificité: CROT antibody was raised against the N terminal of CROT

Purification: Purified

Immunogène: CROT antibody was raised using the N terminal of CROT corresponding to a region with amino acids MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKK

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CROT Blocking Peptide, catalog no. 33R-5938, is also available for use as a blocking control in assays to test for specificity of this CROT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CROT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CROT

Antigène: CROT (Carnitine O-Octanoyltransferase (CROT))

Autre désignation: CROT (CROT Produits)

Synonymes: anticorps CROT, anticorps cot, anticorps zgc:110643, anticorps COT, anticorps 1200003H03Rik, anticorps carnitine O-octanoyltransferase, anticorps CROT, anticorps crot, anticorps Crot

Sujet: Carnitine octanoyltransferase is a carnitine acyltransferase that catalyzes the reversible transfer of fatty acyl groups between CoA and carnitine. This provides a crucial step in the transport of medium- and long-chain acyl-CoA out of the mammalian peroxisome to the cytosol and mitochondria.

Poids moléculaire: 70 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process