DLAT anticorps

N° du produit ABIN629688

Cet anticorps anti-DLAT est un anticorps Lapin Polyclonal détectant DLAT dans WB et IHC. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour DLAT anticorps (ABIN629688)

Antigène: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLAT est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-DLAT anticorps

Purification: Purified

Immunogène: DLAT antibody was raised using a synthetic peptide corresponding to a region with amino acids WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLAT Blocking Peptide, (ABIN935982), is also available for use as a blocking control in assays to test for specificity of this DLAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLAT

Antigène: DLAT (Dihydrolipoyl Transacetylase (DLAT))

Autre désignation: DLAT

Sujet: DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.

Poids moléculaire: 71 kDa (MW of target protein)