PCK1 anticorps (Soluble)

N° du produit ABIN629697

Cet anticorps anti-PCK1 est un anticorps Lapin Polyclonal détectant PCK1 dans WB et IHC. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour PCK1 anticorps (Soluble) (ABIN629697)

Antigène: PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCK1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PCK1 anticorps

Épitope: Soluble

Purification: Purified

Immunogène: PCK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS

Information d'application

Indications d'application: WB: 0.2-1 µg/mL, IHC: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCK1 Blocking Peptide, (ABIN5615257), is also available for use as a blocking control in assays to test for specificity of this PCK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCK1

Antigène: PCK1 (phosphoenolpyruvate Carboxykinase 1 (Soluble) (PCK1))

Autre désignation: PCK1

Sujet: PCK1 is a main control point for the regulation of gluconeogenesis. The cytosolic enzyme encoded by this gene, along with GTP, catalyzes the formation of phosphoenolpyruvate from oxaloacetate, with the release of carbon dioxide and GDP. The expression of PCK1 can be regulated by insulin, glucocorticoids, glucagon, cAMP, and diet.

Poids moléculaire: 69 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis