FDFT1 anticorps (N-Term)

N° du produit ABIN629705

Détail du produit anti-FDFT1 anticorps

Antigène: FDFT1 (Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FDFT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: FDFT1 antibody was raised against the N terminal of FDFT1

Purification: Purified

Immunogène: FDFT1 antibody was raised using the N terminal of FDFT1 corresponding to a region with amino acids HSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRM

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FDFT1 Blocking Peptide, catalog no. 33R-3852, is also available for use as a blocking control in assays to test for specificity of this FDFT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FDFT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FDFT1

Antigène: FDFT1 (Farnesyl-Diphosphate Farnesyltransferase 1 (FDFT1))

Autre désignation: FDFT1 (FDFT1 Produits)

Synonymes: anticorps FDFT1, anticorps DKFZp459C1712, anticorps SQS, anticorps SS, anticorps DGPT, anticorps ERG9, anticorps fdft1, anticorps farnesyl-diphosphate farnesyltransferase 1, anticorps squalene synthase, anticorps farnesyl diphosphate farnesyl transferase 1, anticorps FDFT1, anticorps fdft1, anticorps LOC100560926, anticorps Fdft1

Sujet: FDFT1 is a membrane-associated enzyme located at a branch point in the mevalonate pathway. The protein is the first specific enzyme in cholesterol biosynthesis, catalyzing the dimerization of two molecules of farnesyl diphosphate in a two-step reaction to form squalene.

Poids moléculaire: 48 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha