HMGCS2 anticorps
-
- Antigène Voir toutes HMGCS2 Anticorps
- HMGCS2 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 (Mitochondrial) (HMGCS2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HMGCS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- HMGCS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE
- Top Product
- Discover our top product HMGCS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HMGCS2 Blocking Peptide, catalog no. 33R-2060, is also available for use as a blocking control in assays to test for specificity of this HMGCS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMGCS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HMGCS2 (3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 (Mitochondrial) (HMGCS2))
- Autre désignation
- HMGCS2 (HMGCS2 Produits)
- Synonymes
- anticorps 1300002P16, anticorps mHS, anticorps DDBDRAFT_0219349, anticorps DDBDRAFT_0219924, anticorps DDB_0219349, anticorps DDB_0219924, anticorps Hmgcs1, anticorps Mt3h3mg, anticorps hmgCoA, anticorps 3-hydroxy-3-methylglutaryl-CoA synthase 2, anticorps 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2, anticorps hydroxymethylglutaryl-CoA synthase, anticorps hydroxymethylglutaryl-coa synthase, anticorps 3-HYDROXY-3-METHYLGLUTARYL-CoA SYNTHASE 2, anticorps HMGCS2, anticorps Hmgcs2, anticorps mvaS, anticorps CNC05080, anticorps HMCS1, anticorps hgsA, anticorps MFER_RS00425, anticorps LOC100285783, anticorps ECU10_0510, anticorps Eint_100450
- Sujet
- This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Response to Growth Hormone Stimulus, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha
-