RGS20 anticorps (Middle Region)
-
- Antigène Voir toutes RGS20 Anticorps
- RGS20 (Regulator of G-Protein Signaling 20 (RGS20))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RGS20 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- RGS20 antibody was raised against the middle region of RGS20
- Purification
- Purified
- Immunogène
- RGS20 antibody was raised using the middle region of RGS20 corresponding to a region with amino acids NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS
- Top Product
- Discover our top product RGS20 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RGS20 Blocking Peptide, catalog no. 33R-6636, is also available for use as a blocking control in assays to test for specificity of this RGS20 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RGS20 (Regulator of G-Protein Signaling 20 (RGS20))
- Autre désignation
- RGS20 (RGS20 Produits)
- Sujet
- Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.
- Poids moléculaire
- 27 kDa (MW of target protein)
- Pathways
- Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling
-