RGS13 anticorps (Middle Region)

N° du produit ABIN629717

Détail du produit anti-RGS13 anticorps

Antigène: RGS13 (Regulator of G-Protein Signaling 13 (RGS13))

Épitope: Middle Region

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RGS13 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RGS13 antibody was raised against the middle region of RGS13

Purification: Purified

Immunogène: RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RGS13 Blocking Peptide, catalog no. 33R-10015, is also available for use as a blocking control in assays to test for specificity of this RGS13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RGS13

Antigène: RGS13 (Regulator of G-Protein Signaling 13 (RGS13))

Autre désignation: RGS13 (RGS13 Produits)

Synonymes: anticorps RGD1562103, anticorps regulator of G protein signaling 13, anticorps regulator of G-protein signaling 13, anticorps RGS13, anticorps Rgs13

Sujet: RGS13 encodes a protein which is a member of the regulator of G protein signaling (RGS) family. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation.

Poids moléculaire: 19 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling