MAT1A anticorps (C-Term)

N° du produit ABIN629719

Cet anticorps Lapin Polyclonal détecte spécifiquement MAT1A dans WB. Il présente une réactivité envers Humain et Chien.

Aperçu rapide pour MAT1A anticorps (C-Term) (ABIN629719)

Antigène: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAT1A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAT1A anticorps

Épitope: C-Term

Specificité: MAT1 A antibody was raised against the C terminal of MAT1

Purification: Purified

Immunogène: MAT1 A antibody was raised using the C terminal of MAT1 corresponding to a region with amino acids VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAT1A Blocking Peptide, (ABIN5614679), is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAT1A

Antigène: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Autre désignation: MAT1A

Sujet: MAT1A catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. MAT1A is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in its gene are associated with methionine adenosyltransferase deficiency.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, M Phase, Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process