UBE2K anticorps (N-Term)

N° du produit ABIN629721

Cet anticorps anti-UBE2K est un anticorps Lapin Polyclonal détectant UBE2K dans WB. Adapté pour Humain, Souris, Rat, Poisson zèbre (Danio rerio) et Chien.

Aperçu rapide pour UBE2K anticorps (N-Term) (ABIN629721)

Antigène: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2K est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UBE2K anticorps

Épitope: N-Term

Specificité: HIP2 antibody was raised against the N terminal of HIP2

Purification: Purified

Immunogène: HIP2 antibody was raised using the N terminal of HIP2 corresponding to a region with amino acids MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTP

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HIP2 Blocking Peptide, (ABIN5614004), is also available for use as a blocking control in assays to test for specificity of this HIP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2K

Antigène: UBE2K (Ubiquitin-Conjugating Enzyme E2K (UBE2K))

Autre désignation: HIP2

Sujet: HIP2 belongs to the ubiquitin-conjugating enzyme family. It binds selectively to a large region at the N terminus of huntingtin. This interaction is not influenced by the length of the huntingtin polyglutamine tract. This protein has been implicated in the degradation of huntingtin and suppression of apoptosis.

Poids moléculaire: 22 kDa (MW of target protein)