ATP7A anticorps

N° du produit ABIN629724

Cet anticorps anti-ATP7A est un anticorps Lapin Polyclonal détectant ATP7A dans WB. Adapté pour Humain et Chien.

Aperçu rapide pour ATP7A anticorps (ABIN629724)

Antigène: ATP7A (ATPase, Cu++ Transporting, alpha Polypeptide (ATP7A))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP7A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ATP7A anticorps

Purification: Purified

Immunogène: ATP7 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP7A

Antigène: ATP7A (ATPase, Cu++ Transporting, alpha Polypeptide (ATP7A))

Autre désignation: ATP7A

Sujet: The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Ribonucleoside Biosynthetic Process