ATP7A anticorps

N° du produit ABIN629724

Détail du produit anti-ATP7A anticorps

Antigène: ATP7A (ATPase, Cu++ Transporting, alpha Polypeptide (ATP7A))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP7A est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: ATP7 A antibody was raised using a synthetic peptide corresponding to a region with amino acids MKKQIEAMGFPAFVKKQPKYLKLGAIDVERLKNTPVKSSEGSQQRSPSYQ

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP7A

Antigène: ATP7A (ATPase, Cu++ Transporting, alpha Polypeptide (ATP7A))

Autre désignation: ATP7A (ATP7A Produits)

Synonymes: anticorps ATP7A, anticorps cal, anticorps wu:fc43e01, anticorps zgc:153422, anticorps zgc:158633, anticorps DDBDRAFT_0218568, anticorps DDBDRAFT_0235190, anticorps DDB_0218568, anticorps DDB_0235190, anticorps atpase, anticorps Atp7a, anticorps kal, anticorps atp7a, anticorps DSMAX, anticorps MK, anticorps MNK, anticorps SMAX3, anticorps Blo, anticorps DXHXS1608e, anticorps I14, anticorps Mo, anticorps blotchy, anticorps br, anticorps brindled, anticorps mottled, anticorps Mnk, anticorps ATPase copper transporting alpha, anticorps ATPase, Cu++ transporting, alpha polypeptide, anticorps P-type ATPase, anticorps ATP synthase subunit a, anticorps copper-transporting ATPase 1, anticorps ATP7A, anticorps atp7a, anticorps LOC100049514, anticorps Atp7a, anticorps LOC412379

Sujet: The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Golgi compartment and effluxes excess copper. The trafficking mechanism and catalytic activity combine to facilitate absorption and intercellular transport of copper. Menkes disease, a systemic copper deficiency disorder, is caused by mutations in the ATP7A gene.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Ribonucleoside Biosynthetic Process