RNF165 anticorps (N-Term)

N° du produit ABIN629725

Cet anticorps Lapin Polyclonal détecte spécifiquement RNF165 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour RNF165 anticorps (N-Term) (ABIN629725)

Antigène: RNF165 (Ring Finger Protein 165 (RNF165))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF165 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RNF165 anticorps

Épitope: N-Term

Specificité: RNF165 antibody was raised against the N terminal of RNF165

Purification: Purified

Immunogène: RNF165 antibody was raised using the N terminal of RNF165 corresponding to a region with amino acids MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF165 Blocking Peptide, (ABIN5615891), is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF165 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF165

Antigène: RNF165 (Ring Finger Protein 165 (RNF165))

Autre désignation: RNF165

Sujet: RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.

Poids moléculaire: 39 kDa (MW of target protein)