UBE2I anticorps

N° du produit ABIN629732

Détail du produit anti-UBE2I anticorps

Antigène: UBE2I (Ubiquitin-Conjugating Enzyme E2I (UBE2I))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UBE2I est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: UBE2 I antibody was raised using a synthetic peptide corresponding to a region with amino acids MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UBE2I Blocking Peptide, catalog no. 33R-6431, is also available for use as a blocking control in assays to test for specificity of this UBE2I antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UBE2I

Antigène: UBE2I (Ubiquitin-Conjugating Enzyme E2I (UBE2I))

Autre désignation: UBE2I (UBE2I Produits)

Synonymes: anticorps C358B7.1, anticorps P18, anticorps UBC9, anticorps ubc9, anticorps ube2ia, anticorps zUbc9, anticorps 5830467E05Rik, anticorps F830028O17Rik, anticorps Ubce2i, anticorps Ubce9, anticorps UbcE2A, anticorps ubce9, anticorps T13J8.70, anticorps T13J8_70, anticorps UBIQUITIN-PROTEIN LIGASE, anticorps ubiquitin conjugating enzyme 9, anticorps ubiquitin conjugating enzyme E2 I, anticorps ubiquitin-conjugating enzyme E2Ib, anticorps ubiquitin-conjugating enzyme E2L, anticorps ubiquitin-conjugating enzyme E2I, anticorps ubiquitin conjugating enzyme E2I S homeolog, anticorps ubiquitin conjugating enzyme 9, anticorps SUMO-conjugating enzyme UBC9, anticorps UBE2I, anticorps ube2ib, anticorps UBE2L, anticorps Ube2i, anticorps ube2i.S, anticorps UBC9, anticorps ubc-9, anticorps LOC108703134

Sujet: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2I is a member of the E2 ubiquitin-conjugating enzyme family.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Ubiquitin Proteasome Pathway