SBDS anticorps (C-Term)

N° du produit ABIN629754

Cet anticorps anti-SBDS est un anticorps Lapin Polyclonal détectant SBDS dans WB et IHC. Adapté pour Humain et Chien.

Aperçu rapide pour SBDS anticorps (C-Term) (ABIN629754)

Antigène: SBDS (Shwachman-Bodian-Diamond Syndrome (SBDS))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SBDS est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SBDS anticorps

Épitope: C-Term

Specificité: SBDS antibody was raised against the C terminal of SBDS

Purification: Purified

Immunogène: SBDS antibody was raised using the C terminal of SBDS corresponding to a region with amino acids DYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SBDS Blocking Peptide, (ABIN937623), is also available for use as a blocking control in assays to test for specificity of this SBDS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SBDS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SBDS

Antigène: SBDS (Shwachman-Bodian-Diamond Syndrome (SBDS))

Autre désignation: SBDS

Sujet: SBDS is a member of a highly conserved protein family that exists from archaea to vertebrates and plants. The protein may function in RNA metabolism. Mutations within its gene are associated with Shwachman-Bodian-Diamond syndrome.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly