SIK1 anticorps (N-Term)

N° du produit ABIN629758

Détail du produit anti-SIK1 anticorps

Antigène: SIK1 (Salt-Inducible Kinase 1 (SIK1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIK1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SNF1 LK antibody was raised against the N terminal of SNF1 K

Purification: Purified

Immunogène: SNF1 LK antibody was raised using the N terminal of SNF1 K corresponding to a region with amino acids MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNF1LK Blocking Peptide, catalog no. 33R-6587, is also available for use as a blocking control in assays to test for specificity of this SNF1LK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNF0 K antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIK1

Antigène: SIK1 (Salt-Inducible Kinase 1 (SIK1))

Autre désignation: SNF1LK (SIK1 Produits)

Sujet: SNF1LK play a transient role during the earliest stages of myocardial cell differentiation and/or primitive chamber formation and may also be important for the earliest stages of skeletal muscle growth and/or differentiation. It also plays a potential role in G2/M cell cycle regulation. It inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.

Poids moléculaire: 85 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development, Regulation of Carbohydrate Metabolic Process