ADH4 anticorps

N° du produit ABIN629764

Cet anticorps Lapin Polyclonal détecte spécifiquement ADH4 dans WB et IHC. Il présente une réactivité envers Humain.

Aperçu rapide pour ADH4 anticorps (ABIN629764)

Antigène: ADH4 (Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADH4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ADH4 anticorps

Purification: Purified

Immunogène: ADH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADH4 Blocking Peptide, (ABIN5611950), is also available for use as a blocking control in assays to test for specificity of this ADH4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADH4

Antigène: ADH4 (Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4))

Autre désignation: ADH4

Sujet: ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis