ADH4 anticorps
-
- Antigène Voir toutes ADH4 Anticorps
- ADH4 (Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADH4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- ADH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET
- Top Product
- Discover our top product ADH4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ADH4 Blocking Peptide, catalog no. 33R-6872, is also available for use as a blocking control in assays to test for specificity of this ADH4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ADH4 (Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4))
- Autre désignation
- ADH4 (ADH4 Produits)
- Synonymes
- anticorps ADH-2, anticorps Adh2, anticorps ADH-1, anticorps Ac1002, anticorps alcohol dehydrogenase 4 (class II), pi polypeptide, anticorps alcohol dehydrogenase Adh4, anticorps ADH4, anticorps adh4, anticorps Adh4
- Sujet
- ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole.
- Poids moléculaire
- 42 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-