ACTR2 anticorps

N° du produit ABIN629770

Cet anticorps Lapin Polyclonal détecte spécifiquement ACTR2 dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour ACTR2 anticorps (ABIN629770)

Antigène: ACTR2 (Actin-Related Protein 2 (ACTR2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTR2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ACTR2 anticorps

Purification: Purified

Immunogène: ACTR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVE

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACTR2 Blocking Peptide, (ABIN5611924), is also available for use as a blocking control in assays to test for specificity of this ACTR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACTR2

Antigène: ACTR2 (Actin-Related Protein 2 (ACTR2))

Autre désignation: ACTR2

Sujet: ACTR2 is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Signalisation RTK, Regulation of Actin Filament Polymerization