PGK1 anticorps (C-Term)

N° du produit ABIN629772

Cet anticorps anti-PGK1 est un anticorps Lapin Polyclonal détectant PGK1 dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour PGK1 anticorps (C-Term) (ABIN629772)

Antigène: PGK1 (Phosphoglycerate Kinase 1 (PGK1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PGK1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PGK1 anticorps

Épitope: C-Term

Specificité: PGK1 antibody was raised against the C terminal of PGK1

Purification: Purified

Immunogène: PGK1 antibody was raised using the C terminal of PGK1 corresponding to a region with amino acids ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGK1 Blocking Peptide, (ABIN936960), is also available for use as a blocking control in assays to test for specificity of this PGK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PGK1

Antigène: PGK1 (Phosphoglycerate Kinase 1 (PGK1))

Autre désignation: PGK1

Sujet: PGK1 is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The protein may also act as a cofactor for polymerase alpha.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process