FNTA anticorps (C-Term)

N° du produit ABIN629775

Cet anticorps anti-FNTA Polyclonal Lapin (ABIN629775) détecte spécifiquement FNTA dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour FNTA anticorps (C-Term) (ABIN629775)

Antigène: FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FNTA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FNTA anticorps

Épitope: C-Term

Specificité: FNTA antibody was raised against the C terminal of FNTA

Purification: Purified

Immunogène: FNTA antibody was raised using the C terminal of FNTA corresponding to a region with amino acids DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FNTA Blocking Peptide, (ABIN937469), is also available for use as a blocking control in assays to test for specificity of this FNTA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FNTA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FNTA

Antigène: FNTA (Farnesyltransferase, CAAX Box, alpha (FNTA))

Autre désignation: FNTA

Sujet: Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein's with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Response to Water Deprivation, Regulation of G-Protein Coupled Receptor Protein Signaling