CES1 anticorps
-
- Antigène Voir toutes CES1 Anticorps
- CES1 (Carboxylesterase 1 (CES1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CES1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- Carboxylesterase 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATS
- Top Product
- Discover our top product CES1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Carboxylesterase 1 Blocking Peptide, catalog no. 33R-9660, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CES1 (Carboxylesterase 1 (CES1))
- Autre désignation
- Carboxylesterase 1 (CES1 Produits)
- Synonymes
- anticorps ACAT, anticorps CE-1, anticorps CEH, anticorps CES2, anticorps HMSE, anticorps HMSE1, anticorps PCE-1, anticorps REH, anticorps SES1, anticorps TGH, anticorps hCE-1, anticorps CESDD1, anticorps CES1, anticorps CES-K1, anticorps APLE, anticorps PMPMEase, anticorps CES, anticorps carboxylesterase 1, anticorps liver carboxylesterase 1, anticorps liver carboxylesterase, anticorps carboxylesterase 1 (monocyte/macrophage serine esterase 1), anticorps CES1, anticorps CpipJ_CPIJ013026, anticorps CpipJ_CPIJ016339, anticorps LOC100009551, anticorps LOC454097, anticorps LOC699486, anticorps LOC100050915
- Sujet
- CES1 is one of the enzymes responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. This enzyme is known to hydrolyze aromatic and aliphatic esters and is necessary for cellular cholesterol esterification.
- Poids moléculaire
- 61 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-