FBP1 anticorps (N-Term)

N° du produit ABIN629795

L’anticorps Lapin Polyclonal anti-FBP1 a été validé pour WB et IHC. Il convient pour détecter FBP1 dans des échantillons de Humain et Souris.

Aperçu rapide pour FBP1 anticorps (N-Term) (ABIN629795)

Antigène: FBP1 (Fructose-1,6-Bisphosphatase 1 (FBP1))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBP1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-FBP1 anticorps

Épitope: N-Term

Specificité: FBP1 antibody was raised against the N terminal of FBP1

Purification: Purified

Immunogène: FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBP1 Blocking Peptide, (ABIN936269), is also available for use as a blocking control in assays to test for specificity of this FBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBP1

Antigène: FBP1 (Fructose-1,6-Bisphosphatase 1 (FBP1))

Autre désignation: FBP1

Sujet: Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process, Regulation of Carbohydrate Metabolic Process, Dicarboxylic Acid Transport