DCTPP1 anticorps (N-Term)

N° du produit ABIN629798

Détail du produit anti-DCTPP1 anticorps

Antigène: DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DCTPP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: XTP3 TPA antibody was raised against the N terminal of XTP3 PA

Purification: Purified

Immunogène: XTP3 TPA antibody was raised using the N terminal of XTP3 PA corresponding to a region with amino acids MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

XTP3TPA Blocking Peptide, catalog no. 33R-6521, is also available for use as a blocking control in assays to test for specificity of this XTP3TPA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XTP0 PA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DCTPP1

Antigène: DCTPP1 (DCTP Pyrophosphatase 1 (DCTPP1))

Autre désignation: XTP3TPA (DCTPP1 Produits)

Synonymes: anticorps RS21C6, anticorps XTP3TPA, anticorps 2410015N17Rik, anticorps AI854235, anticorps RS21-C6, anticorps Rs21c6, anticorps Xtp3tpa, anticorps xtp3tpa, anticorps dCTP pyrophosphatase 1, anticorps dCTP pyrophosphatase 1 L homeolog, anticorps DCTPP1, anticorps Dctpp1, anticorps dctpp1.L, anticorps dctpp1

Sujet: XTP3TPA is involved in identical protein binding, dCTP diphosphatase activity, pyrimidine deoxyribonucleotide binding and hydrolase activity.

Poids moléculaire: 19 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome