PKLR anticorps (N-Term)

N° du produit ABIN629803

Cet anticorps Lapin Polyclonal détecte spécifiquement PKLR dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat, Chien et C. elegans.

Aperçu rapide pour PKLR anticorps (N-Term) (ABIN629803)

Antigène: PKLR (Pyruvate Kinase, Liver and RBC (PKLR))

Reactivité: Humain, Souris, Rat, Chien, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PKLR est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PKLR anticorps

Épitope: N-Term

Specificité: PKLR antibody was raised against the N terminal of PKLR

Purification: Purified

Immunogène: PKLR antibody was raised using the N terminal of PKLR corresponding to a region with amino acids STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PKLR Blocking Peptide, (ABIN5615398), is also available for use as a blocking control in assays to test for specificity of this PKLR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PKLR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PKLR

Antigène: PKLR (Pyruvate Kinase, Liver and RBC (PKLR))

Autre désignation: PKLR

Sujet: PKLR is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA).

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process