Desmin anticorps (N-Term)

N° du produit ABIN629811

Cet anticorps anti-Desmin est un anticorps Lapin Polyclonal détectant Desmin dans WB. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour Desmin anticorps (N-Term) (ABIN629811)

Antigène: Desmin (DES)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Desmin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Desmin anticorps

Épitope: N-Term

Specificité: Desmin antibody was raised against the N terminal of DES

Purification: Purified

Immunogène: Desmin antibody was raised using the N terminal of DES corresponding to a region with amino acids PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Desmin Blocking Peptide, (ABIN5613181), is also available for use as a blocking control in assays to test for specificity of this Desmin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Desmin

Antigène: Desmin (DES)

Autre désignation: Desmin

Sujet: DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Poids moléculaire: 52 kDa (MW of target protein)